Protein Info for IAI47_01990 in Pantoea sp. MT58

Annotation: LysE family translocator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 41 to 68 (28 residues), see Phobius details amino acids 77 to 96 (20 residues), see Phobius details amino acids 122 to 140 (19 residues), see Phobius details amino acids 146 to 172 (27 residues), see Phobius details amino acids 180 to 199 (20 residues), see Phobius details PF01810: LysE" amino acids 16 to 190 (175 residues), 62.1 bits, see alignment E=2.5e-21

Best Hits

Swiss-Prot: 30% identical to EAMB_SALTI: Cysteine/O-acetylserine efflux protein (eamB) from Salmonella typhi

KEGG orthology group: None (inferred from 97% identity to pva:Pvag_2915)

Predicted SEED Role

"Transporter, LysE family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (200 amino acids)

>IAI47_01990 LysE family translocator (Pantoea sp. MT58)
MELSLFLSMLGFLWVAAITPGPNNMLLTASGANFGFLRTIPLMIGIMIGMQVMLLMVAFG
VGGLILLYPSLHLMLKIAGSLYLLWLAWKIATASYAKLETDQAPDAPMPFWQGGLLQLIN
PKAWLMALGAVASFSLAGDAYRHSVMAISVGMFLVNLVSGVIWMGFGAMIGRILRSRRAW
RIFNLAMGLLTAACVLLIWH