Protein Info for IAI47_01960 in Pantoea sp. MT58

Annotation: FUSC family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 691 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 37 to 53 (17 residues), see Phobius details amino acids 62 to 80 (19 residues), see Phobius details amino acids 85 to 104 (20 residues), see Phobius details amino acids 111 to 130 (20 residues), see Phobius details amino acids 136 to 156 (21 residues), see Phobius details amino acids 366 to 384 (19 residues), see Phobius details amino acids 390 to 407 (18 residues), see Phobius details amino acids 419 to 450 (32 residues), see Phobius details amino acids 456 to 475 (20 residues), see Phobius details amino acids 487 to 506 (20 residues), see Phobius details TIGR01667: integral membrane protein, YccS/YhfK family" amino acids 12 to 671 (660 residues), 661.3 bits, see alignment E=8.1e-203 PF12805: FUSC-like" amino acids 63 to 330 (268 residues), 213 bits, see alignment E=5e-67 PF13515: FUSC_2" amino acids 378 to 498 (121 residues), 75.9 bits, see alignment E=3.2e-25

Best Hits

Swiss-Prot: 68% identical to YHFK_ECOLI: Uncharacterized protein YhfK (yhfK) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to pva:Pvag_2921)

Predicted SEED Role

"FIG00638035: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (691 amino acids)

>IAI47_01960 FUSC family protein (Pantoea sp. MT58)
MWRRIIYHPEVNYALRQTLVLCLPVALGWLAGDLQKGLLFSLVPACCNIAGLDTPHKRFF
KRLIVGGSLFALGSFLIQWLTLHAIPLPLILFAMPLLLGVTGEISPLHGRLLPGTLIAAI
FTLSLIGRMPIYVTPLLYIGGTLWYGLFNWFWFWLWKEQPMRESLSLIYRELANYCDAKY
TLLTQLTDPEKALPPLLARQQKVVDLINTCYQQMHMLSASRDHSHKRLTRAFQVALDLQE
HISVSLHRPEEVQKLVEQSHAEAVIRWNAKTISARLRVLADNILYHQLPDRFAMDKQLGA
LEKIAHQHPDNPVGNFCLYHFNRIARVLRTQKPLYQRDLMADRQRRLPLLPALRSYLSFR
SSALRTAGRFAVMLMLGSALALFFNIPKPYWILMTIMFVSQNGYSATRVRIQHRALGTFA
GLVIAAATLRLAVPESLVLLIMLAITFISYRFTRQFYGWSMIGFTVTAVYSLQLLSLNGA
QFLLPRLMDTLMGCLIAFGGMLWLWPQWQSGLLRQNAHDALEADQDALRLLLGNEQSPEK
LAYQRVKVNQAHNALFNSLNQAMQEPAFNSRYLSDMRLWVTHSQFIVEHINAITILAREH
TMLTDSLAERYLQSCEIALQRCQQRLEYDGESSQVNLLDDLENISEGPVTVVEQHVRRIL
DHLSVMYTISSLAWNQRPQHGRWLIRRLRKN