Protein Info for IAI47_01845 in Pantoea sp. MT58

Annotation: GMP/IMP nucleotidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00702: Hydrolase
  • amino acids 7 to 178 (172 residues), 61.3 bits, E=1.7e-20
• PF13419: HAD_2
  • amino acids 10 to 181 (172 residues), 28.9 bits, E=1.2e-10
• TIGR01509: HAD hydrolase, family IA, variant 3
  • amino acids 51 to 187 (137 residues), 44.5 bits, E=8.9e-16

Best Hits

Swiss-Prot: 63% identical to YRFG_SHIFL: GMP/IMP nucleotidase YrfG (yrfG) from Shigella flexneri

KEGG orthology group: K07025, putative hydrolase of the HAD superfamily (inferred from 94% identity to pva:Pvag_2946)

MetaCyc: 63% identical to purine nucleotidase (Escherichia coli K-12 substr. MG1655)
5'-nucleotidase. [EC: 3.1.3.5, 3.1.3.99]; 3.1.3.5 [EC: 3.1.3.5, 3.1.3.99]

Predicted SEED Role

"FIG001957: putative hydrolase"

MetaCyc Pathways

• purine nucleotides degradation II (aerobic) (11/11 steps found)
• ureide biosynthesis (7/7 steps found)
• adenosine nucleotides degradation II (5/5 steps found)
• purine nucleotides degradation I (plants) (10/12 steps found)
• adenosine nucleotides degradation I (7/8 steps found)
• guanosine nucleotides degradation II (4/4 steps found)
• guanosine nucleotides degradation III (4/4 steps found)
• inosine 5'-phosphate degradation (4/4 steps found)
• NAD salvage pathway III (to nicotinamide riboside) (3/3 steps found)
• superpathway of guanosine nucleotides degradation (plants) (5/6 steps found)
• guanosine nucleotides degradation I (3/4 steps found)
• superpathway of purines degradation in plants (13/18 steps found)
• UTP and CTP dephosphorylation I (5/7 steps found)
• NAD salvage (plants) (5/11 steps found)
• tunicamycin biosynthesis (2/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Nicotinate and nicotinamide metabolism
• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.5

Use Curated BLAST to search for 3.1.3.5 or 3.1.3.99

Protein Sequence (215 amino acids)

>IAI47_01845 GMP/IMP nucleotidase (Pantoea sp. MT58)
MLNWSEIDTVLLDMDGTLLDLAFDRHFWLEHVPEQLSQQRGISRAEADAIIAEKYQAVAH
TLNWYCLDYWADALKLDIRAMTLAMRSLIALRDDTLPFLQALRRAGKSTILLTNAHPYNL
DVKLAQTGLAPHLDLLLSTHTFGYPKEDQRLWQAVQQHTGFSAARTLFIDDNEVILDAAT
LWGIGWCLGVKNPDSGRPEQIFQRHRATGDYRTLI