Protein Info for IAI47_01740 in Pantoea sp. MT58

Annotation: triphosphoribosyl-dephospho-CoA synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 TIGR03132: triphosphoribosyl-dephospho-CoA synthase MdcB" amino acids 13 to 278 (266 residues), 307.8 bits, see alignment E=3.5e-96 PF01874: CitG" amino acids 17 to 276 (260 residues), 227.2 bits, see alignment E=1.6e-71

Best Hits

Swiss-Prot: 75% identical to MDCB_KLEPN: 2-(5''-triphosphoribosyl)-3'-dephosphocoenzyme-A synthase (mdcB) from Klebsiella pneumoniae

KEGG orthology group: K13930, triphosphoribosyl-dephospho-CoA synthase [EC: 2.7.8.25] (inferred from 93% identity to pva:Pvag_2969)

MetaCyc: 75% identical to 2-(5''-triphosphoribosyl)-3'-dephosphocoenzyme-A synthase (Klebsiella pneumoniae)
2.7.8.25-RXN [EC: 2.4.2.52]

Predicted SEED Role

"Triphosphoribosyl-dephospho-CoA synthetase (EC 2.7.8.25)" in subsystem Malonate decarboxylase (EC 2.7.8.25)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.52 or 2.7.8.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (286 amino acids)

>IAI47_01740 triphosphoribosyl-dephospho-CoA synthase (Pantoea sp. MT58)
MKLLSQTHAEAQASHLATIARDCLIDEARLSPKPGLVDSRGNGAHRDLTLALMERSAHSL
MPIFLALARHSWLRPADIALRETVGRLGRDGEQQMMAATGGVNTHRGAIWALGLLVSAAA
MQGGTTTADTLARTAAALASLPDSHAPRVFSKGLKATHRYQVPGAREEAQQAFPHVMKLA
LPQLLISRAVGASESEARLDALMAIMTSLSDTCVLSRAGMTGLDAMQQGARAVLLAGGCR
TAAGQRALQQLDRRMLALNASPGGAADLLAATLFIDRVCSPEHSYF