Protein Info for IAI47_01595 in Pantoea sp. MT58

Annotation: sn-glycerol-3-phosphate ABC transporter permease UgpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 78 to 100 (23 residues), see Phobius details amino acids 110 to 131 (22 residues), see Phobius details amino acids 157 to 181 (25 residues), see Phobius details amino acids 206 to 228 (23 residues), see Phobius details amino acids 267 to 287 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 86 to 292 (207 residues), 60.9 bits, see alignment E=6.9e-21

Best Hits

Swiss-Prot: 80% identical to UGPA_PECAS: sn-glycerol-3-phosphate transport system permease protein UgpA (ugpA) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K05814, sn-glycerol 3-phosphate transport system permease protein (inferred from 99% identity to pva:Pvag_3000)

MetaCyc: 79% identical to sn-glycerol 3-phosphate ABC transporter membrane subunit UgpA (Escherichia coli K-12 substr. MG1655)
ABC-34-RXN [EC: 7.6.2.10]; 7.6.2.10 [EC: 7.6.2.10]

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, permease protein UgpA (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (295 amino acids)

>IAI47_01595 sn-glycerol-3-phosphate ABC transporter permease UgpA (Pantoea sp. MT58)
MSSSRPVFRTSLLPYLLVLPQLLITAIFFLWPAGEALWYSLQSLDPFGISSSFVGLENFR
RLFADPYYLDSFWTTIKFSGMVTVFGMVFSLLLAALVDYVVRLRRLYQTLLLLPYAVAPV
VAAVLWMFLFNPGLGLFSYLLNHVGYNWNFAQNSGQAMFLVVLASIWQQMSYNFLFFFAA
LQSIPKSLVEAAAIDGAGPVRRFFNLSLPLITPVSFFLLVVNLIYAFFDTFPVIDAATGG
GPVQATTTLIYKIYREGFTGLDLSSSAAQSVVLMLLVIGLTVLQFRFVERKVQYQ