Protein Info for IAI47_01590 in Pantoea sp. MT58

Annotation: sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF01547: SBP_bac_1" amino acids 40 to 337 (298 residues), 121.8 bits, see alignment E=6.1e-39 PF13416: SBP_bac_8" amino acids 46 to 358 (313 residues), 131.8 bits, see alignment E=4.2e-42

Best Hits

Swiss-Prot: 82% identical to UGPB_YERPS: sn-glycerol-3-phosphate-binding periplasmic protein UgpB (ugpB) from Yersinia pseudotuberculosis serotype I (strain IP32953)

KEGG orthology group: K05813, sn-glycerol 3-phosphate transport system substrate-binding protein (inferred from 99% identity to pva:Pvag_3001)

MetaCyc: 79% identical to sn-glycerol 3-phosphate ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-34-RXN [EC: 7.6.2.10]; 7.6.2.10 [EC: 7.6.2.10]

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, periplasmic glycerol-3-phosphate-binding protein (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (438 amino acids)

>IAI47_01590 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB (Pantoea sp. MT58)
MSVVTFRRSLMSALLGLTLCSHAMAATEIPFWHSMEGELGKEVDSLAQRFNETHPDYKIV
PTYKGNYEQSLAAGIAAVRSGKAPAVLQVYEVGTATMMASKAIVPVHQVFKDAGIPFDEK
QFVPTVAGYYSDSKGQLISQPFNSSTPVLYYNKDAFKKAGLNPDQPPKTWQELATDAAAL
RKSGMSCGYASGWQGWIQIENFSAWHALPVATENNGFDGLDAVLEFNKPVQVRHIELLEA
MNKKGDFTYFGRKDESTAKFYNGDCGITTASSGSLADIRHYAKFNFGVGMMPYDDTVPNA
PQNALIGGASLWVMKGKDAATYKGVAEFMQFLAKPEIAAEWHQKTGYLPITTAAYELTKQ
QGFYDKNPGADIATRQMMNKPPLPFTKGMRLGNMPQIRTVIDEELESVWTGKQSPQSALD
NAVKRGNELLRRFQQQVK