Protein Info for IAI47_01560 in Pantoea sp. MT58

Annotation: aspartate 1-decarboxylase autocleavage activator PanM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 131 PF12568: PanZ" amino acids 2 to 126 (125 residues), 164.6 bits, see alignment E=7.6e-53 PF00583: Acetyltransf_1" amino acids 21 to 119 (99 residues), 23.2 bits, see alignment E=7.3e-09

Best Hits

Swiss-Prot: 58% identical to PANZ_SALTY: PanD regulatory factor (panM) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 91% identity to pva:Pvag_3007)

MetaCyc: 56% identical to PanD maturation factor (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"probable acetyltransferase YPO3809"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (131 amino acids)

>IAI47_01560 aspartate 1-decarboxylase autocleavage activator PanM (Pantoea sp. MT58)
MKLTIQRLTTLTAQDRIDLGKVWPDLEIEKLEQHLDERHRLYAARFNDRLLAGLQLEISG
MHGKVHRLTVRDVTRRRGVGQYLLEETIRQNGSISDWWIADDGSDDQQVRAAFMQACGFR
AQSDGWILAVE