Protein Info for IAI47_01550 in Pantoea sp. MT58

Annotation: cell division protein FtsX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 transmembrane" amino acids 47 to 70 (24 residues), see Phobius details amino acids 189 to 216 (28 residues), see Phobius details amino acids 243 to 266 (24 residues), see Phobius details amino acids 271 to 292 (22 residues), see Phobius details amino acids 298 to 318 (21 residues), see Phobius details TIGR00439: putative protein insertion permease FtsX" amino acids 27 to 326 (300 residues), 452 bits, see alignment E=5e-140 PF18075: FtsX_ECD" amino acids 85 to 179 (95 residues), 58.4 bits, see alignment E=8.8e-20 PF02687: FtsX" amino acids 202 to 315 (114 residues), 46 bits, see alignment E=4.9e-16

Best Hits

Swiss-Prot: 75% identical to FTSX_SHIFL: Cell division protein FtsX (ftsX) from Shigella flexneri

KEGG orthology group: K09811, cell division transport system permease protein (inferred from 99% identity to pva:Pvag_3009)

Predicted SEED Role

"Cell division protein FtsX" in subsystem Bacterial Cell Division

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (327 amino acids)

>IAI47_01550 cell division protein FtsX (Pantoea sp. MT58)
MVNKRIKRPAAPKAKQPSKSKALKGGWQEQWRYALRGTLSDMWRQPLATLLTVMVIAISL
TLPSVCYMVWKNVSQAATQWYPAPQLTVYLSKTLDDTAAENVVAQLKQVEGVDNVNYLTR
EEALNEFRNWSGFGGAMDMLEQNPLPAVAIITPKLNFQNSDTMQSLRDRVTKVQGVDEVR
MDDSWFARLAALTGLVGQIASMIGVLMIVAVFLVIGNSVRLSIFARRDTINVQKLIGATD
GFILRPFLYGGALLGFSGAVLSLLLSEVLVLRLQSVVASVATVFGTTFSLEGFSWDEALL
LLLIAAIIGWVAAWLATVQHLRRFTPQ