Protein Info for IAI47_01485 in Pantoea sp. MT58

Annotation: 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione acylhydrolase (decyclizing)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 646 TIGR04377: 3,5/4-trihydroxycyclohexa-1,2-dione hydrolase" amino acids 5 to 644 (640 residues), 973.5 bits, see alignment E=2.6e-297 PF02776: TPP_enzyme_N" amino acids 8 to 134 (127 residues), 62.1 bits, see alignment E=6.6e-21 PF00205: TPP_enzyme_M" amino acids 220 to 353 (134 residues), 115.1 bits, see alignment E=3e-37 PF02775: TPP_enzyme_C" amino acids 442 to 601 (160 residues), 129.3 bits, see alignment E=1.7e-41

Best Hits

Swiss-Prot: 66% identical to IOLD_GEOKA: 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase (iolD) from Geobacillus kaustophilus (strain HTA426)

KEGG orthology group: K03336, 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [EC: 3.7.1.-] (inferred from 98% identity to pva:Pvag_3023)

Predicted SEED Role

"Epi-inositol hydrolase (EC 3.7.1.-)" in subsystem Inositol catabolism (EC 3.7.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.7.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (646 amino acids)

>IAI47_01485 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione acylhydrolase (decyclizing) (Pantoea sp. MT58)
MSTIRLTTAQALVKFLDNQFIDVDGVETKFVKGIFAIFGHGNVLGLGQALEQDSGDLMVY
QGRNEQGMAHAATGFARQSLRRQIIACSSSVGPGAANMITAAATATANRIPLLLLPGDVF
ATRQPDPVLQQIEQSYDLSISTNDAFRAVSKYWDRVSRPEQLMSACINAMRVLTDPAETG
AVTLSLPQDVQGEAWDYPDYFFQKRVHRLDRRLPVAAQLADALTLINRKRKPMIICGGGV
KYSEAGEALRQFAERYQIPFAETQAGKGTLVSDHPLNVGGVGETGCLAANLLAKEADLVI
GIGTRYTDFTTASKWIFQHPDVSFLNINVSNFDSYKLDGVQLLADAREGLTALTAALASQ
HYSNDWGNQIEQAQSQLLKETQRVYQVEYHDGDFVPEIADHLDREAVFAEFNRLTQSLLT
QSSVLGTLNEQLPKDAVVVAAAGSLPGDLQRVWRTKDYNAYHVEYGYSCMGYEVNAALGV
KLAQPQREVYALVGDGSFMMLHSELVTSIQEGAKINVVLLDNMTNGCINNLQMEHGMDSF
TTEFRFRNPEGGKLDGGFIPVDFAAIAAGYGCKTYRVTTLEQLKAALEDARTQTVSTLID
IKVLPKTMIHKYFSWWHVGVAQASKTERAQAVADKLNSHLDQARKY