Protein Info for IAI47_01455 in Pantoea sp. MT58

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 52 to 71 (20 residues), see Phobius details amino acids 88 to 110 (23 residues), see Phobius details amino acids 116 to 142 (27 residues), see Phobius details amino acids 154 to 176 (23 residues), see Phobius details amino acids 182 to 201 (20 residues), see Phobius details amino acids 222 to 246 (25 residues), see Phobius details amino acids 253 to 273 (21 residues), see Phobius details amino acids 285 to 304 (20 residues), see Phobius details amino acids 311 to 332 (22 residues), see Phobius details amino acids 344 to 368 (25 residues), see Phobius details amino acids 374 to 393 (20 residues), see Phobius details PF07690: MFS_1" amino acids 29 to 272 (244 residues), 72.4 bits, see alignment E=1.7e-24 amino acids 235 to 403 (169 residues), 54.2 bits, see alignment E=5.8e-19

Best Hits

Swiss-Prot: 69% identical to YHHS_SHIFL: Uncharacterized MFS-type transporter YhhS (yhhS) from Shigella flexneri

KEGG orthology group: None (inferred from 80% identity to pao:Pat9b_3734)

Predicted SEED Role

"Transporter, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (407 amino acids)

>IAI47_01455 MFS transporter (Pantoea sp. MT58)
MPEQPAAEPTTPHGNLNISLLILSIVAYNFASYLTIGLPLAVLPGWVHDQLGFSAFWAGL
VISLQYVATLLSRPHAGRYADIWGPKKVVVTGLVGCLISGLCILLAALIASPMWSLILLC
VGRLILGVGQSFTGTGTSLWGVARVGSLHIGRVISWNGIVTYGAMAIGAPLGVVIFQAGG
LLWLSLVIVAICVVGIVCAVPRPAVKASRARPLPFRAVLGKIAGFGAILAMGSAGFGVIA
TFITLFYQDKGWQGAAFALSLFSMAFVGARLLFPNAINRHGGLRVASVCLAVEAAGLFLV
AAAGNPWMANAGAFLTGAGFSLVFPALGVVAVKVVPQQNQGSALATYTAFMDLSLGITGP
LAGFIMNYADVSRVYLLTALLVCVAFFCTLRLLKRQASQSAADGSSE