Protein Info for IAI47_01400 in Pantoea sp. MT58

Annotation: sugar porter family MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 transmembrane" amino acids 14 to 44 (31 residues), see Phobius details amino acids 56 to 75 (20 residues), see Phobius details amino acids 84 to 101 (18 residues), see Phobius details amino acids 113 to 131 (19 residues), see Phobius details amino acids 143 to 160 (18 residues), see Phobius details amino acids 172 to 191 (20 residues), see Phobius details amino acids 251 to 274 (24 residues), see Phobius details amino acids 290 to 311 (22 residues), see Phobius details amino acids 321 to 341 (21 residues), see Phobius details amino acids 349 to 373 (25 residues), see Phobius details amino acids 385 to 406 (22 residues), see Phobius details amino acids 418 to 436 (19 residues), see Phobius details TIGR00879: MFS transporter, sugar porter (SP) family" amino acids 6 to 447 (442 residues), 472.2 bits, see alignment E=9.6e-146 PF00083: Sugar_tr" amino acids 18 to 450 (433 residues), 451.8 bits, see alignment E=4.3e-139 PF07690: MFS_1" amino acids 23 to 309 (287 residues), 123.3 bits, see alignment E=1.7e-39 amino acids 285 to 445 (161 residues), 42.7 bits, see alignment E=5.5e-15 PF06609: TRI12" amino acids 35 to 203 (169 residues), 25.5 bits, see alignment E=6.8e-10

Best Hits

Swiss-Prot: 73% identical to GALP_ECOLI: Galactose-proton symporter (galP) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to pva:Pvag_3042)

MetaCyc: 73% identical to galactose:H+ symporter (Escherichia coli K-12 substr. MG1655)
RXN0-7077; TRANS-RXN-21

Predicted SEED Role

"Arabinose-proton symporter" in subsystem L-Arabinose utilization

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (462 amino acids)

>IAI47_01400 sugar porter family MFS transporter (Pantoea sp. MT58)
MVATKKSGSQQNRFTWFVCFMAALSGLLFGLDIGVIAGALPFLAKDLQITNHQQEWVVSS
MMFGAALGALAAGWMSSKLGRKKSMLAGATLFVIGSLWSAFSPDVESLVCARVMLGLAVG
IASYTAPLYLAEIAPERIRGSMISMYQLMLTTGIVVAYLSDTAFSYSGNWRGMLGVIAIP
AVILFIGVLFLPNSPRWLAAHGRFNEAQRVLDRLRNSSEQAREELEEIRESLQVKQRGWS
LFRSNGNFRRAVWLGMLLQVMQQFTGMNVVMYYAPKIFNIAGFSSTSEQMWGTVIVGLVN
MLATLIAIFFVDRWGRKPMLTTSFLVMAVGMGVLGTLLHMGVETDFRKYFAVAMLLMFIV
GFAMAAGPVIWLLCSEIQPLKGRDFGITASTTTNWVGNMIVGATFLTMLDQLGNANTFWF
YGALNLVFIVLTMMLVPETKHVTLEHIERNLMKGKALRDIGA