Protein Info for IAI47_01335 in Pantoea sp. MT58

Annotation: CPBP family intramembrane metalloprotease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 35 to 53 (19 residues), see Phobius details amino acids 65 to 84 (20 residues), see Phobius details amino acids 108 to 127 (20 residues), see Phobius details amino acids 138 to 163 (26 residues), see Phobius details amino acids 169 to 190 (22 residues), see Phobius details amino acids 202 to 220 (19 residues), see Phobius details amino acids 223 to 241 (19 residues), see Phobius details amino acids 247 to 270 (24 residues), see Phobius details PF02517: Rce1-like" amino acids 169 to 259 (91 residues), 77 bits, see alignment E=5.4e-26

Best Hits

KEGG orthology group: K07052, (no description) (inferred from 90% identity to pva:Pvag_3056)

Predicted SEED Role

"Putative membrane protein precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (272 amino acids)

>IAI47_01335 CPBP family intramembrane metalloprotease (Pantoea sp. MT58)
MWILLAGALGALQPARRLALLLLALVALLGFYHQVLTWPVLPLLGGIAALVALRRFDPIR
SRQQILSEALLVLISLGLFLHLFPGFNNPLQVDEVQTGARSLPFSFSFNADKALIPFVLL
ACLPTLFRARACPPRYPWIAALTLITAVPLLLCSAVLLGGLAFELHNPPWLPAFMLANLF
FVSLAEEALFRGYLQQRLRESLGGMPALLICSLLFGLAHIQGGVLLVVFASLAGLIYGLA
WHWSGRLWLATALHFALNLTHLLFFTYPALHH