Protein Info for IAI47_01305 in Pantoea sp. MT58

Annotation: ABC transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 69 to 91 (23 residues), see Phobius details amino acids 104 to 129 (26 residues), see Phobius details amino acids 156 to 178 (23 residues), see Phobius details amino acids 198 to 219 (22 residues), see Phobius details amino acids 224 to 243 (20 residues), see Phobius details amino acids 255 to 280 (26 residues), see Phobius details PF00528: BPD_transp_1" amino acids 97 to 280 (184 residues), 39.6 bits, see alignment E=2.3e-14

Best Hits

KEGG orthology group: K02054, putative spermidine/putrescine transport system permease protein (inferred from 96% identity to pam:PANA_3776)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (289 amino acids)

>IAI47_01305 ABC transporter permease subunit (Pantoea sp. MT58)
MKMRNRNRLSWLLVLPAVAPVVLTLVLIVIMALAQSVGLFNFGAPAHFTLQYWQTILNDS
QLWRATGYSLKIGVISAVLSVALALPLALWLRKPFPGSMLMGGLLKAPLMVHGLVAALLF
INLISWQGFINLGLLKLGIISHPIRMQNDRWGTGVIILQVWKQLPYALLIITGSLRAIGD
EIFNAARDLGAGRAARLLQIILPLSIKSVQVSLVLIFIGALGDFSFQVVAGPTSVFSLSQ
YMLRFPEISAQGWNLAAVVAVILMLAAFVGAVVLAALAKWLQQVGEQRS