Protein Info for IAI47_01295 in Pantoea sp. MT58

Annotation: extracellular solute-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF01547: SBP_bac_1" amino acids 51 to 313 (263 residues), 44.5 bits, see alignment E=2.2e-15 PF13416: SBP_bac_8" amino acids 56 to 333 (278 residues), 79.6 bits, see alignment E=3.6e-26

Best Hits

KEGG orthology group: K05777, putative thiamine transport system substrate-binding protein (inferred from 95% identity to pam:PANA_3778)

Predicted SEED Role

"Possible ABC transporter, periplasmic substrate X binding protein precursor" in subsystem ABC transporter of unknown substrate X

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (367 amino acids)

>IAI47_01295 extracellular solute-binding protein (Pantoea sp. MT58)
MFRFVAAILLLAGAFCSQAQDLTTMNWEQIVEQAKKEGELTWYQWYYQDRLKEQVSLFEK
QYGINVTLSEGTLQGNINKLMADRGRDTGDIDLFSIGGGAFGTVSPQKTFFGPINTLLPA
GKTLNYTIEGTDSKGYGVAFWGNQTGLAYDSRRLKESELPRTLPQITAFLQRHRQEFGFN
VENGGSGPAFIESVTRTRVPGFDFTKGDADLKSLTALQPAWNWFKQQRPNYIITASNADS
VTRLVSGEFLLVPAWEDYLVGLENHGEVPKTIRLYIPDFGMPGGGNMVAIPVNAPHKAAA
LLFIHWLTLPTTQRLFQQVYGITPQNKDVNRDAGLINSKERIHGTQFMPKPLGDEVRTEF
SNQVLLR