Protein Info for IAI47_01205 in Pantoea sp. MT58

Annotation: GNAT family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13302: Acetyltransf_3
  • amino acids 3 to 138 (136 residues), 51.2 bits, E=6.8e-17
• PF13420: Acetyltransf_4
  • amino acids 5 to 153 (149 residues), 47.2 bits, E=7.5e-16
• PF00583: Acetyltransf_1
  • amino acids 40 to 137 (98 residues), 75.7 bits, E=1.1e-24
• PF13673: Acetyltransf_10
  • amino acids 45 to 145 (101 residues), 40.5 bits, E=7.7e-14
• PF13508: Acetyltransf_7
  • amino acids 53 to 139 (87 residues), 56 bits, E=1.3e-18
• PF08445: FR47
  • amino acids 83 to 139 (57 residues), 23.9 bits, E=1e-08

Best Hits

Swiss-Prot: 40% identical to AAAT_ECOLI: L-amino acid N-acetyltransferase AaaT (aaaT) from Escherichia coli (strain K12)

KEGG orthology group: K03825, putative acetyltransferase [EC: 2.3.1.-] (inferred from 95% identity to pva:Pvag_3074)

Predicted SEED Role

"FIG01201438: hypothetical protein"

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Protein Sequence (166 amino acids)

>IAI47_01205 GNAT family N-acetyltransferase (Pantoea sp. MT58)
MEIIIRAREPQDAAAYQRLYSHPDVYPWTLQLPFPSVATWEKKIARMDAEGFIAFVAEID
DELVGELTLFVDNKPRTRHCISFGLGVHPDFGGRGVGERLIRTAMDYSRNWLGITRMELE
VFHDNERALRLYERLGFEREGVMRQAALRDGQLRDVVMMAKLLHEK