Protein Info for IAI47_01200 in Pantoea sp. MT58

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 610 transmembrane" amino acids 40 to 61 (22 residues), see Phobius details amino acids 81 to 101 (21 residues), see Phobius details amino acids 158 to 179 (22 residues), see Phobius details amino acids 185 to 204 (20 residues), see Phobius details amino acids 271 to 291 (21 residues), see Phobius details amino acids 297 to 320 (24 residues), see Phobius details PF00664: ABC_membrane" amino acids 43 to 302 (260 residues), 49.2 bits, see alignment E=6.1e-17 PF00005: ABC_tran" amino acids 379 to 532 (154 residues), 114.7 bits, see alignment E=5.4e-37

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 96% identity to pva:Pvag_3075)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (610 amino acids)

>IAI47_01200 ABC transporter ATP-binding protein (Pantoea sp. MT58)
MLYRRFERFINIFHDAPTDSPPSTVWSFYLYYLRQVWPSFAALLVVGLASALIEVSLFSY
LSRIIDMVNHSTPASLFQDNWPILLWMGAVALILRPIFIALHDMLVHQSISPGMTNLIRW
QNHNYVLRQSLNFFQNDFAGRIAQRIMLTGSSLRDSAVQLVDAIWHVLIYAVTSLVLFAD
ADWRLMIPLIIWMVAYSASLRFFVPRVKARSVVSSESRSKLMGTIVDGYTNIATIKLFAH
SDLERKYAREAMQEQTEKTQHAGRMVTSMDLTLSALNGLLIVSTSALALWLWSQSLISVG
AIALSTGLVIRLVNMSGWIMWVVNGIFENIGTVQDGLKTIAQPLSVQDAPQAKQLKVTRG
NIRFEDVRFDYGGGRQVINGFNLDIKPGEKIGLIGPSGAGKSTLVNLLLRLYDLNGGRIV
IDDQDIAAVTQESLRSQIGMITQDTSLLHRSIRENLLYGRPDASEEELQLAIHRARADEF
IPLLSDSLGRTGLDAHVGERGVKLSGGQRQRVAIARVLLKDAPVLIMDEATSALDSEVEA
AIQESLESLMQGKTVIAIAHRLSTIAKMDRLVVLDKGGIAEMGSHHELLAQNGLYARLWQ
HQTGGFVGID