Protein Info for IAI47_01185 in Pantoea sp. MT58

Annotation: glutathione S-transferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 PF13409: GST_N_2" amino acids 57 to 150 (94 residues), 45.4 bits, see alignment E=1.5e-15 PF13410: GST_C_2" amino acids 199 to 269 (71 residues), 55.1 bits, see alignment E=9.6e-19

Best Hits

Swiss-Prot: 48% identical to YQJG_ECOLI: Glutathionyl-hydroquinone reductase YqjG (yqjG) from Escherichia coli (strain K12)

KEGG orthology group: K07393, putative glutathione S-transferase (inferred from 94% identity to pva:Pvag_3078)

MetaCyc: 48% identical to glutathionyl-hydroquinone reductase YqjG (Escherichia coli K-12 substr. MG1655)
RXN0-7010 [EC: 1.8.5.7]

Predicted SEED Role

"Glutathione S-transferase, omega (EC 2.5.1.18)" in subsystem Glutathione: Non-redox reactions (EC 2.5.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 1.8.5.7 or 2.5.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (313 amino acids)

>IAI47_01185 glutathione S-transferase family protein (Pantoea sp. MT58)
MLVEGKWSSDWHPVQATDKQGGFVRQTSGFRHFISSDGSTEFAAEPDRYHLYVALICPWA
SRALMARKLKGLESMISVTVVEPQLGAQGWRFGTFPGAQQDPLNNAQYLHEIYTRVAPDY
TGRATVPVLWDKKTGTIVNNESADIVRMFNSGFGDLADNRIDLYPAALRQEIDALNESLY
QRLNNGVYRAGFATTALSYQQAFNDVFSQLDELEALLSDGRTFLLGERLTESDIRLFVTL
IRFDAAYHGLFKCNLRRIRDYTLLNRYLKSMLSVSGVRETVSIDHIKQGYYSIKALNPNG
IVPAGPDMSEYNL