Protein Info for IAI47_01175 in Pantoea sp. MT58

Annotation: sugar phosphate isomerase/epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 PF01261: AP_endonuc_2" amino acids 21 to 266 (246 residues), 124.5 bits, see alignment E=3e-40

Best Hits

KEGG orthology group: K00457, 4-hydroxyphenylpyruvate dioxygenase [EC: 1.13.11.27] (inferred from 93% identity to pva:Pvag_3080)

Predicted SEED Role

"4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27)" in subsystem Aromatic amino acid degradation or Homogentisate pathway of aromatic compound degradation or Plastoquinone Biosynthesis or Tocopherol Biosynthesis (EC 1.13.11.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (271 amino acids)

>IAI47_01175 sugar phosphate isomerase/epimerase (Pantoea sp. MT58)
MRTNPTFLNLVLLNGEPDQKLQAARDAGFDQVEIWREDVDAYEGGAAALAEISALKGPGF
TNLQVLRDFTGAPGALRCQKREELRQFIQIARTLGCDTIQAPASTREDCCADQIDDDLRW
MASEAARYNMRIMYEPMAWCSVDNTLPLAWQRLQRLDQPNIGLVVDLFHICALGGDASQL
DGIPADRIYEVQLCDMAAVPAQDKHSLMAMAKHHRQLPGDGIIDVERFVDKLKSAGYQGP
VGIEVFNDTLKRLPPDVAARHAWQALNRYWG