Protein Info for IAI47_01160 in Pantoea sp. MT58

Annotation: zinc-binding alcohol dehydrogenase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 PF08240: ADH_N" amino acids 28 to 132 (105 residues), 113 bits, see alignment E=1.3e-36 PF16912: Glu_dehyd_C" amino acids 142 to 340 (199 residues), 36 bits, see alignment E=1.1e-12 PF00107: ADH_zinc_N" amino acids 173 to 300 (128 residues), 83.2 bits, see alignment E=3.3e-27

Best Hits

Swiss-Prot: 66% identical to LGOD_ECOLI: L-galactonate-5-dehydrogenase (lgoD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 96% identity to pva:Pvag_3084)

MetaCyc: 66% identical to L-galactonate oxidoreductase (Escherichia coli K-12 substr. MG1655)
RXN0-5229 [EC: 1.1.1.414]

Predicted SEED Role

"Sorbitol dehydrogenase (EC 1.1.1.14)" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization (EC 1.1.1.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.14 or 1.1.1.414

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (342 amino acids)

>IAI47_01160 zinc-binding alcohol dehydrogenase family protein (Pantoea sp. MT58)
MTTMKALVIAEPRKMVWATRDTPTPAAGEALIKILTAGICGTDIHAWSGNQPFFSYPRVL
GHEICAEVVALGSGAEGFQAGQRVALMPYISCLRCDACQSGKTNCCEQISVIGVHQDGGF
CDYLSVPVSTLLAVDEVAPEAAALIEPFAISAHAVRRAGIVADEQVLVVGAGPIGLGVAA
IAAASGAQVVVADTSEFRRQHVADQLGLAALNPADEAFYSALRDQFGGRLALKVIDATGS
PAAMNNAVNLMRHGGTIVYVGLHKGDLVIPDSEFHKKETTLMGSRNATREDFNLVSALMA
SGQLRAEMMLNHHLAFSTLDETFESQVINNRELIKGVIHFDR