Protein Info for IAI47_01150 in Pantoea sp. MT58

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 transmembrane" amino acids 35 to 55 (21 residues), see Phobius details amino acids 75 to 100 (26 residues), see Phobius details amino acids 107 to 127 (21 residues), see Phobius details amino acids 169 to 191 (23 residues), see Phobius details amino acids 197 to 215 (19 residues), see Phobius details amino acids 258 to 278 (21 residues), see Phobius details amino acids 296 to 320 (25 residues), see Phobius details amino acids 332 to 351 (20 residues), see Phobius details amino acids 357 to 379 (23 residues), see Phobius details amino acids 393 to 414 (22 residues), see Phobius details amino acids 420 to 441 (22 residues), see Phobius details PF07690: MFS_1" amino acids 46 to 407 (362 residues), 186.7 bits, see alignment E=3e-59

Best Hits

Swiss-Prot: 75% identical to LGOT_ECOLI: Probable L-galactonate transporter (lgoT) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to pva:Pvag_3086)

MetaCyc: 75% identical to galactonate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-227

Predicted SEED Role

"D-galactonate transporter" in subsystem D-galactonate catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (450 amino acids)

>IAI47_01150 MFS transporter (Pantoea sp. MT58)
MEKTSVTGRDSVTGDTPPGQDFVPMRSDVVRSPRIRKVQITAMLLLLFAAIINYLDRSSL
SVANMTIRDEMGLSATEIGFLLSAFSLAYGLAQLPCGALLDRKGPRIMLGIGMFIWSLFQ
AASGLVHNFTQFILVRIGLGIGEAPMNPCGVKVINDWFNIKDRGMPMGMFNAASMIGLSV
APPILAAMMLVMGWRGMFVTIGILGMFLAIGWYMIYRDRDNNTLSAEEIHYLQAGSVASR
KEPISFKEWRGLFKQRTMWGMMIGFSGINYTAWLYIAWLPGYLQSTYHLDLKSTGLLAAI
PFLFGAAGMLLNGYVVDSLVRRGFNAVKTRKVCIVSGMLLSAGFTAVVTRATDTTSAVTL
IGMALFCIHFAGTSCWGLIHANVTARMTASVGSIQNFASFIFASFAPVITGWVLDTTKSF
SLALMICACVTLVGALAYLLLVRQPITDGE