Protein Info for IAI47_01060 in Pantoea sp. MT58

Annotation: inner membrane protein YhjD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 transmembrane" amino acids 37 to 53 (17 residues), see Phobius details amino acids 67 to 92 (26 residues), see Phobius details amino acids 130 to 149 (20 residues), see Phobius details amino acids 182 to 204 (23 residues), see Phobius details amino acids 224 to 246 (23 residues), see Phobius details amino acids 258 to 278 (21 residues), see Phobius details amino acids 292 to 317 (26 residues), see Phobius details TIGR00766: inner membrane protein YhjD" amino acids 48 to 322 (275 residues), 407.6 bits, see alignment E=1e-126 PF03631: Virul_fac_BrkB" amino acids 62 to 321 (260 residues), 156.3 bits, see alignment E=6e-50

Best Hits

Swiss-Prot: 70% identical to YHJD_ECOLI: Inner membrane protein YhjD (yhjD) from Escherichia coli (strain K12)

KEGG orthology group: K07058, membrane protein (inferred from 96% identity to pva:Pvag_3103)

Predicted SEED Role

"Inner membrane protein YhjD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (339 amino acids)

>IAI47_01060 inner membrane protein YhjD (Pantoea sp. MT58)
MTDKQENPQDLQPQKPLIDIKTGNHTVDESIVRVSRFATWFQAIPAVAHFIRALDRFNDR
LGSQFGAAITYFSFLSLIPILMVSFAAVGFVLASNPDLLTDIINKIVSSISDPTLATTLK
NTVNTAIQQRATVGITGLLLALYSGLNWMGNLREAIRAQSRDVWERKPDDKEKIWKRYIR
DLLSLAGLMLALVITLSLTSVAGSAQASIVSALGLDGIDWLRPALTIIATSISVMANYLL
FLWIFWILPRHKPRKKALFRGTLLAAIGFEVIKFVMTLTLPKMATSPSGAAFGSVLGLMA
FFYFFARLTLFCAAWIATAKYKDDPQMPEAGSASRHKSS