Protein Info for IAI47_01055 in Pantoea sp. MT58

Annotation: MHS family MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 transmembrane" amino acids 26 to 54 (29 residues), see Phobius details amino acids 65 to 86 (22 residues), see Phobius details amino acids 97 to 116 (20 residues), see Phobius details amino acids 124 to 150 (27 residues), see Phobius details amino acids 168 to 189 (22 residues), see Phobius details amino acids 201 to 220 (20 residues), see Phobius details amino acids 241 to 269 (29 residues), see Phobius details amino acids 291 to 313 (23 residues), see Phobius details amino acids 322 to 340 (19 residues), see Phobius details amino acids 346 to 370 (25 residues), see Phobius details amino acids 384 to 403 (20 residues), see Phobius details amino acids 411 to 431 (21 residues), see Phobius details PF00083: Sugar_tr" amino acids 24 to 234 (211 residues), 90.3 bits, see alignment E=1.4e-29 amino acids 271 to 442 (172 residues), 45 bits, see alignment E=7.7e-16 PF07690: MFS_1" amino acids 30 to 284 (255 residues), 66.8 bits, see alignment E=1.7e-22 amino acids 284 to 431 (148 residues), 54.2 bits, see alignment E=1.2e-18 TIGR00883: MFS transporter, metabolite:H+ symporter (MHS) family protein" amino acids 31 to 426 (396 residues), 502.8 bits, see alignment E=3.7e-155

Best Hits

Swiss-Prot: 82% identical to YHJE_ECOLI: Inner membrane metabolite transport protein YhjE (yhjE) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to pva:Pvag_3104)

Predicted SEED Role

"Inner membrane metabolite transport protein YhjE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (443 amino acids)

>IAI47_01055 MHS family MFS transporter (Pantoea sp. MT58)
MQASLTDTLDKQQDPTPVNSRSKVVIASLVGTAIEFFDFYIYATAAVIVFPHIFFPQGDA
TVATLQSLATFAIAFIARPIGSAVFGHFGDRVGRKATLVASLLTMGISTVVIGLLPSYET
IGVMAPLLLALARFGQGLGLGGEWGGAALLATENAPAKKRALYGSFPQLGAPIGFFFANG
TFLLLSWLLTDEQFMQWGWRVPFILSAVLVLVGLYVRVSLHESPVFAKVQKEKKQVRVPI
AALLSKHLTATILGTFIMLATYTLFYIMTVYSMSYGTTAAPAGLGIPRNSMLWMLMLAVI
GFGVMVPIAGLLADRFGRRKTMITITLMIIGFSFLFPAMLGSGSQALVMAFLLLGLSIMG
LTFGPMGALLPELFPTEVRYTGASFSYNLSSILGASVAPYIATWLNAHYGLQAVGLYLAS
MAVLTLIALLACKETRHQTLYDV