Protein Info for IAI47_00945 in Pantoea sp. MT58

Annotation: YijD family membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 117 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 36 to 52 (17 residues), see Phobius details amino acids 64 to 83 (20 residues), see Phobius details amino acids 91 to 109 (19 residues), see Phobius details PF07226: DUF1422" amino acids 7 to 115 (109 residues), 159.7 bits, see alignment E=1.3e-51

Best Hits

Swiss-Prot: 60% identical to YIJD_ECOL6: Inner membrane protein YijD (yijD) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 99% identity to pva:Pvag_3125)

Predicted SEED Role

"Putative inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (117 amino acids)

>IAI47_00945 YijD family membrane protein (Pantoea sp. MT58)
MTHPGTRDKSTLALAFITGLAINGSFSVLFSAFVPFSIFPLIALGLAAWCLHQRYLNTNM
PDGMPGLAAAFFLLGILVYSALVRAEYPDIGSNFVPTVLMVALVFWIATRFKRKRNQ