Protein Info for IAI47_00940 in Pantoea sp. MT58

Annotation: HTH-type transcriptional repressor FabR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 PF00440: TetR_N" amino acids 17 to 58 (42 residues), 34.3 bits, see alignment 8.2e-13

Best Hits

Swiss-Prot: 94% identical to FABR_YERE8: HTH-type transcriptional repressor FabR (fabR) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: None (inferred from 99% identity to pva:Pvag_3126)

Predicted SEED Role

"Unsaturated fatty acid biosythesis repressor FabR, TetR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (215 amino acids)

>IAI47_00940 HTH-type transcriptional repressor FabR (Pantoea sp. MT58)
MGVRAQQKERTRRTLIEAAFSQLSAERSFASLSLREVAREAGIAPTSFYRHFKDVDELGL
TMVDESGLMLRQLMRQARQRIAKGGSIIKTSVSTFMEFIGNNPNAFRLLLRERSGTSAAF
RAAVAREIQHFIAELADYLEVENRMPRSFTEAQAEAMVTIVFSAGAEALDVDAEQRRKLE
DRLVLQLRMIAKGAYYWYRREQERLAVTLEKPEEQ