Protein Info for IAI47_00910 in Pantoea sp. MT58

Annotation: acetylglutamate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00696: AA_kinase
  • amino acids 5 to 235 (231 residues), 144.7 bits, E=2e-46
• TIGR00761: acetylglutamate kinase
  • amino acids 5 to 234 (230 residues), 246.8 bits, E=1e-77

Best Hits

Swiss-Prot: 83% identical to ARGB_CROS8: Acetylglutamate kinase (argB) from Cronobacter sakazakii (strain ATCC BAA-894)

KEGG orthology group: K00930, acetylglutamate/acetylaminoadipate kinase [EC: 2.7.2.- 2.7.2.8] (inferred from 97% identity to pva:Pvag_3133)

MetaCyc: 81% identical to acetylglutamate kinase (Escherichia coli K-12 substr. MG1655)
Acetylglutamate kinase. [EC: 2.7.2.8]

Predicted SEED Role

"Acetylglutamate kinase (EC 2.7.2.8)" in subsystem Arginine Biosynthesis extended (EC 2.7.2.8)

MetaCyc Pathways

• superpathway of arginine and polyamine biosynthesis (16/17 steps found)
• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• L-arginine biosynthesis II (acetyl cycle) (9/10 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• L-ornithine biosynthesis I (5/5 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Lysine biosynthesis
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.- or 2.7.2.8

Protein Sequence (258 amino acids)

>IAI47_00910 acetylglutamate kinase (Pantoea sp. MT58)
MTNPLIIKLGGVLLDSEEALARLFEALLKYRSAHQRPLLIVHGGGCLVDELMKKLALPVM
KKNGLRVTPPDQIDIITGALAGTANKTLLAWAKKSGINAVGLCLGDAGIVNVAPFDDELG
HVGHATPGNPALLNTLLAAGYMPVVSSIGITDSGDLMNVNADQAATALASTLGADLVLLS
DVSGILDGKGQRIEEMTADKAEQLISQGIITDGMIVKVHAALDAARTLGRPVDIASWRHA
ERLTDLFNGVSIGTRILA