Protein Info for IAI47_00855 in Pantoea sp. MT58

Annotation: cell division protein FtsN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02223: cell division protein FtsN
  • amino acids 1 to 322 (322 residues), 252 bits, E=4.6e-79
• PF05036: SPOR
  • amino acids 254 to 322 (69 residues), 63.7 bits, E=8.4e-22

Best Hits

Swiss-Prot: 55% identical to FTSN_ECOLI: Cell division protein FtsN (ftsN) from Escherichia coli (strain K12)

KEGG orthology group: K03591, cell division protein FtsN (inferred from 89% identity to pva:Pvag_3146)

MetaCyc: 55% identical to cell division protein FtsN (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Cell division protein FtsN" in subsystem Bacterial Cytoskeleton

Protein Sequence (328 amino acids)

>IAI47_00855 cell division protein FtsN (Pantoea sp. MT58)
MAQKDYVGRGRSTGTRRKKSPSRGKKSKGGSGTSKLMIVLAVAVLVTFAGGLWFLAHHKK
EDVPVITDHKANGNGLPPKPEERWKYIKELENRQVTVPTPIEPSSGGEVKSQTQLTDEQR
QLLEQMQADMRQQPTQLNEVPWNEQTPAQRQQTLQHQQQLQQLQRQQQQVQQQQQVQQQR
QQLQAQQQQQRQLQLQQQQQRQQQQQLQRQQQQQQQQQQNVQRQSQPAPVTREPDVQTKP
QETAKAKPAEKASSQRWMVQCGSFKGTDQAESVRAGLAFEGFESRITTGGGWNRVVIGPY
KDRASADSTLKRLRSSGHSSCIPLSVGG