Protein Info for IAI47_00830 in Pantoea sp. MT58

Annotation: aquaporin family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 79% identical to GLPF_ECO57: Glycerol uptake facilitator protein (glpF) from Escherichia coli O157:H7

KEGG orthology group: K02440, glycerol uptake facilitator protein (inferred from 98% identity to pva:Pvag_3151)

MetaCyc: 79% identical to glycerol facilitator (Escherichia coli K-12 substr. MG1655)
RXN0-7189; RXN0-7191; TRANS-RXN-131; TRANS-RXN0-460; TRANS-RXN0-536; TRANS-RXN0-537; TRANS-RXN0-551

Predicted SEED Role

"Glycerol uptake facilitator protein" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerol fermenation to 1,3-propanediol

MetaCyc Pathways

glycerol and glycerophosphodiester degradation (4/4 steps found)
glycerol degradation I (3/3 steps found)
arsenate detoxification III (2/2 steps found)
arsenic detoxification (plants) (4/6 steps found)
arsenic detoxification (mammals) (8/17 steps found)
arsenic detoxification (yeast) (4/12 steps found)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (283 amino acids)

>IAI47_00830 aquaporin family protein (Pantoea sp. MT58)
MSQTTNTLKGQCIAEFLGTGLIIFFGAGCVAALKLAGAAFGQWEICIIWGLAVSMAVYLT
AGVSGAHLNPAVTVALCLFANFEGRKVVPYILAQIAGAFCAAALVYGLYYSLFFDYEQSH
QMVRGTVQSLDLAGIFSTYPNPHISVGQAFLVEMVITAVLMAVIMALTDDGNGVPRGPMA
PLLIGLLVAVIGGSMGPLTGFALNPARDFGPKLFAFFAGWGNVAFTGGKDIPYFLVPIFG
PLVGACLGAVGYRTLIGRYLPGAAQEPSVPADKPVARAQQRKA