Protein Info for IAI47_00755 in Pantoea sp. MT58

Annotation: envelope stress sensor histidine kinase CpxA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 165 to 186 (22 residues), see Phobius details PF16527: CpxA_peri" amino acids 80 to 146 (67 residues), 41.5 bits, see alignment E=3.4e-14 PF00672: HAMP" amino acids 181 to 233 (53 residues), 43.6 bits, see alignment 6.2e-15 PF00512: HisKA" amino acids 239 to 299 (61 residues), 53 bits, see alignment E=5.7e-18 PF02518: HATPase_c" amino acids 346 to 454 (109 residues), 86 bits, see alignment E=4.9e-28

Best Hits

Swiss-Prot: 86% identical to CPXA_ECOL6: Sensor protein CpxA (cpxA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K07640, two-component system, OmpR family, sensor histidine kinase CpxA [EC: 2.7.13.3] (inferred from 100% identity to pva:Pvag_3168)

MetaCyc: 86% identical to sensor histidine kinase CpxA (Escherichia coli K-12 substr. MG1655)
Protein-histidine tele-kinase. [EC: 2.7.13.2]

Predicted SEED Role

"Copper sensory histidine kinase CpxA" in subsystem Orphan regulatory proteins

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.2 or 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (459 amino acids)

>IAI47_00755 envelope stress sensor histidine kinase CpxA (Pantoea sp. MT58)
MIGSLTTRIFAIFWLTLALVLMLVLMVPKLDSRQMTSLLESEQRQGIMIEQHVEAELSQD
PPNDLMWWRRLFRAVEKWAPPGQRLLLVTSEGRVIGAQHNEMQVIRNFIGQSDNADHPQK
KKYGRVELVGPFAVRDGEDNYQLYMIRPANSSQLDFVNLLFDRPLLLLIVTMLISSPLLL
WLAWSLARPARKLKYAADEVASGNLRQHPELESGPQEFLAAGSSFNQMVSALERMMTGQQ
RLLSDISHELRTPLTRLQLATALLRRRQGEGKELGRIEMEAQRLDGMINDLLVLSRTQHK
NALVSEAMKANQLWNGVLEDARFEAEQMGKKMDIPYPPGPWPLYGNPHALESALENIVRN
ALRYSHTHISVSFSVDISGITVHVDDDGPGVSPEDREQIFRPFYRTDEARDRESGGTGLG
LAIVETAVQQHRGWVKADDSPLGGLRLTLWLPLYSSGRQ