Protein Info for IAI47_00725 in Pantoea sp. MT58

Annotation: rhodanese-like domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 143 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details PF00581: Rhodanese" amino acids 43 to 134 (92 residues), 74.7 bits, see alignment E=3.5e-25

Best Hits

Swiss-Prot: 64% identical to YIBN_ECO57: Uncharacterized protein YibN (yibN) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 97% identity to pva:Pvag_3174)

Predicted SEED Role

"FIG136845: Rhodanese-related sulfurtransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (143 amino acids)

>IAI47_00725 rhodanese-like domain-containing protein (Pantoea sp. MT58)
MQEIMQFASNHPILSLAWVVLLVLVIVTTVKGMFSKVKTISRGEATRLINKEDAVVVDVR
SRDDFRRGHISGAVNVAAAEIKKGNIDELAKHKAQPIIVVCATGQSAGDSAAHLSAAGFE
QVSVLKDGISGWSGENLPLVRGK