Protein Info for IAI47_00700 in Pantoea sp. MT58

Annotation: L-threonine 3-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00692: L-threonine 3-dehydrogenase
  • amino acids 3 to 341 (339 residues), 590.3 bits, E=5.2e-182
• PF08240: ADH_N
  • amino acids 27 to 135 (109 residues), 115.2 bits, E=2e-37
• PF00107: ADH_zinc_N
  • amino acids 175 to 304 (130 residues), 100 bits, E=1.5e-32
• PF13602: ADH_zinc_N_2
  • amino acids 228 to 339 (112 residues), 30.4 bits, E=1.1e-10

Best Hits

Swiss-Prot: 88% identical to TDH_KLEP7: L-threonine 3-dehydrogenase (tdh) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K00060, threonine 3-dehydrogenase [EC: 1.1.1.103] (inferred from 98% identity to pva:Pvag_3179)

MetaCyc: 88% identical to threonine dehydrogenase (Escherichia coli K-12 substr. MG1655)
L-threonine 3-dehydrogenase. [EC: 1.1.1.103]

Predicted SEED Role

"L-threonine 3-dehydrogenase (EC 1.1.1.103)" in subsystem Glycine Biosynthesis or Threonine degradation (EC 1.1.1.103)

MetaCyc Pathways

• superpathway of L-threonine metabolism (15/18 steps found)
• L-threonine degradation II (2/2 steps found)
• L-threonine degradation III (to methylglyoxal) (2/3 steps found)
• aminopropanol phosphate biosynthesis II (2/4 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.103

Protein Sequence (342 amino acids)

>IAI47_00700 L-threonine 3-dehydrogenase (Pantoea sp. MT58)
MKALAKLKKEEGIWMVTDAPVPEPGHNDLLIKIRKTAICGTDVHIYNWDDWSRKTIPVPM
IVGHEYVGEVVAIGQEVKGFTIGDRVSGEGHITCGHCRNCRAGRTHLCRNTMGVGVNRQG
CFAEYLVIPAFNAFKIPDNISDELAAIFDPFGNAVHTALSFDLVGEDVLISGAGPIGIMA
AAVCRHVGARNVVITDINEYRLELARKMGVTRAVNVANENLRDVMHSLGMTEGFDVGLEM
SGAPPAFRSLLEVMNHGGRIALLGIPPGEMAIDWNQVIFKGLFIKGIYGREMFETWYKMA
ALIQSGLDLTPVITHRFGIDDFQQGFDEMRSGRSGKVILNWN