Protein Info for IAI47_00670 in Pantoea sp. MT58

Annotation: sugar glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01501: Glyco_transf_8
  • amino acids 29 to 269 (241 residues), 169.6 bits, E=1e-53
• PF08437: Glyco_transf_8C
  • amino acids 276 to 327 (52 residues), 41 bits, 1.6e-14

Best Hits

KEGG orthology group: K03279, UDP-glucose:(galactosyl)LPS alpha-1,2-glucosyltransferase [EC: 2.4.1.58] (inferred from 93% identity to pva:Pvag_3186)

Predicted SEED Role

"Glycosyl transferase, family 8"

MetaCyc Pathways

• superpathway of Kdo₂-lipid A biosynthesis (19/25 steps found)
• lipid A-core biosynthesis (E. coli K-12) (4/10 steps found)

KEGG Metabolic Maps

• Lipopolysaccharide biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.58

Protein Sequence (334 amino acids)

>IAI47_00670 sugar glycosyltransferase (Pantoea sp. MT58)
MAITPLADAVQQSQLLVNTLADTDDNPVHVAFGINHAYARGLGITLFSLLSHHPDTAFHA
HIFSDSLRDEDVEKLRSLASGHRLSITLHIFNSDWVDQLPAVGRYPKSIHYRFLIPETVA
SYSDRVIYIDADTLVVGDYSPLFTLDLTDYTLAACNDTPRARQNQCAKLGLKHHHYFNSG
FMLINIPRWLERQTTARITDVLVKRGAEFGFPDQDALNIVLEDEILILPDRYNQIYDIIA
NKVWDHSTVPTDTVMIHYTGKCKPWHAWAGSDLARRYHGYYQRSPWAVQPLDTPKHYKEM
KRFARIKWHQKQYAESISWMMKYVSLKFFKQSEQ