Protein Info for IAI47_00555 in Pantoea sp. MT58
Annotation: kdo(2)-lipid IV(A) palmitoleoyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 69% identical to LPXP_SHIFL: Lipid A biosynthesis palmitoleoyltransferase (lpxP) from Shigella flexneri
KEGG orthology group: K12974, palmitoleoyl transferase [EC: 2.3.1.-] (inferred from 97% identity to pva:Pvag_3205)MetaCyc: 69% identical to palmitoleoyl acyltransferase (Escherichia coli K-12 substr. MG1655)
PALMITOTRANS-RXN [EC: 2.3.1.242]
Predicted SEED Role
"Lipid A biosynthesis lauroyl acyltransferase (EC 2.3.1.-)" in subsystem KDO2-Lipid A biosynthesis (EC 2.3.1.-)
MetaCyc Pathways
- superpathway of (Kdo)2-lipid A biosynthesis (17/17 steps found)
- superpathway of Kdo2-lipid A biosynthesis (19/25 steps found)
- (Kdo)2-lipid A biosynthesis (E. coli) (2/2 steps found)
KEGG Metabolic Maps
- 1- and 2-Methylnaphthalene degradation
- Alkaloid biosynthesis I
- Alkaloid biosynthesis II
- Anthocyanin biosynthesis
- Benzoate degradation via CoA ligation
- Biosynthesis of terpenoids and steroids
- Biosynthesis of type II polyketide backbone
- Biosynthesis of unsaturated fatty acids
- Butanoate metabolism
- Carotenoid biosynthesis - General
- Diterpenoid biosynthesis
- Ether lipid metabolism
- Ethylbenzene degradation
- Fatty acid biosynthesis
- Glycerophospholipid metabolism
- Glycosphingolipid biosynthesis - ganglio series
- Histidine metabolism
- Limonene and pinene degradation
- Lipopolysaccharide biosynthesis
- Lysine degradation
- Phenylalanine metabolism
- Tyrosine metabolism
Isozymes
Compare fitness of predicted isozymes for: 2.3.1.-
Use Curated BLAST to search for 2.3.1.- or 2.3.1.242
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (307 amino acids)
>IAI47_00555 kdo(2)-lipid IV(A) palmitoleoyltransferase (Pantoea sp. MT58) MKNTGKFSSSLLHPRYWFTWFGLGVLWLLVQLPYPVLMRLGAGAGKISRHFLQRRERITR RNIELCFPGISEEKIEHMIAGNFASLGMALAETGIAWFWSDRAVKRLFNVSGMDNLHAAQ NEKRGVMLIGVHFMSLELGGRISGLCQPMMAMYRPHNNQAMEYVQTKGRMRSNKAMIDRR DLRGMVHALKQGESVWFAPDQDYGPKGSTFAPLFAVEKAATTNGTFVLSRLAKPAMVPIM LIRNPGNDGYHLIIEPMLENYPHTDEAAAAAYMNKVIENQILRAPEQYLWLHRRFKTRPP GEQSLYI