Protein Info for IAI47_00535 in Pantoea sp. MT58

Annotation: oligosaccharide flippase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 transmembrane" amino acids 13 to 35 (23 residues), see Phobius details amino acids 41 to 58 (18 residues), see Phobius details amino acids 79 to 99 (21 residues), see Phobius details amino acids 110 to 128 (19 residues), see Phobius details amino acids 145 to 166 (22 residues), see Phobius details amino acids 172 to 190 (19 residues), see Phobius details PF01943: Polysacc_synt" amino acids 12 to 208 (197 residues), 73.5 bits, see alignment E=2e-24 PF13440: Polysacc_synt_3" amino acids 31 to 208 (178 residues), 85.7 bits, see alignment E=3.4e-28

Best Hits

KEGG orthology group: None (inferred from 97% identity to pva:Pvag_3208)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (214 amino acids)

>IAI47_00535 oligosaccharide flippase family protein (Pantoea sp. MT58)
MAIRESSLNSAKWSLLSSIKIIGIGVLQLSLLAQILQANELNLLAIAIIALLFIDTLADR
GFSNTLIRRCMLSINDLSTIYWGNMLMGVAVFGLLFTGSHLLNSLFNQPELALMLQMVSV
VFIIIPQGQHYRAVLQREKQYTRIAFAETSSVLAGLAVTLFTVWLTPSVLCAIWGYLAMA
SIRMLIYCYYGRSWFQPEYHFSLNAFAKIRARNK