Protein Info for IAI47_00475 in Pantoea sp. MT58

Annotation: virulence factor BrkB family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 36 to 61 (26 residues), see Phobius details amino acids 98 to 117 (20 residues), see Phobius details amino acids 137 to 162 (26 residues), see Phobius details amino acids 180 to 199 (20 residues), see Phobius details amino acids 210 to 233 (24 residues), see Phobius details amino acids 239 to 271 (33 residues), see Phobius details TIGR00765: YihY family inner membrane protein" amino acids 16 to 273 (258 residues), 306.9 bits, see alignment E=7.3e-96 PF03631: Virul_fac_BrkB" amino acids 26 to 273 (248 residues), 204.5 bits, see alignment E=1.2e-64

Best Hits

Swiss-Prot: 75% identical to YIHY_ECOSE: UPF0761 membrane protein YihY (yihY) from Escherichia coli (strain SE11)

KEGG orthology group: K07058, membrane protein (inferred from 97% identity to pva:Pvag_3220)

Predicted SEED Role

"Ribonuclease BN (EC 3.1.-.-)" in subsystem LMPTP YfkJ cluster or tRNA processing (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (290 amino acids)

>IAI47_00475 virulence factor BrkB family protein (Pantoea sp. MT58)
MMSRKFRPRLHAFWLWLRLLWKRIDEDGMTTQAGNLAYVSLLALVPLIAVVFALFAAFPV
FSDISVQLKQFVFNNLMPAAGNTLQRYLEQFVANVNRMTAVGAVGLIVTALLLMHSVDTA
LNTIWRSNKKRPMVYSFAVYWMILTLGPLLAGASLAISSYLLSLRWINATGVTSLVDQML
RIFPLLLSWFAFWLLYSIVPTQRVPPRDALIGALVAGALFELGKKGFALYVTMFPSYQLI
YGVLAVIPILFLWVYWTWCIVLLGAEITVALADYRQLKQQHQQEEQREET