Protein Info for IAI47_00425 in Pantoea sp. MT58

Annotation: thiol:disulfide interchange protein DsbA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13462: Thioredoxin_4
  • amino acids 39 to 181 (143 residues), 38.3 bits, E=1.6e-13
• PF01323: DSBA
  • amino acids 40 to 195 (156 residues), 93 bits, E=2.1e-30

Best Hits

Swiss-Prot: 69% identical to DSBA_SHIFL: Thiol:disulfide interchange protein DsbA (dsbA) from Shigella flexneri

KEGG orthology group: K03673, thiol:disulfide interchange protein DsbA (inferred from 99% identity to pva:Pvag_3230)

MetaCyc: 69% identical to thiol:disulfide oxidoreductase DsbA (Escherichia coli K-12 substr. MG1655)
RXN-21426 [EC: 1.8.4.15]; 1.8.4.15 [EC: 1.8.4.15]

Predicted SEED Role

"Periplasmic thiol:disulfide interchange protein DsbA" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange

MetaCyc Pathways

• cytochrome c biogenesis (system I type) (9/11 steps found)
• periplasmic disulfide bond formation (1/3 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.15

Protein Sequence (209 amino acids)

>IAI47_00425 thiol:disulfide interchange protein DsbA (Pantoea sp. MT58)
MKKIWFALMGLVLAFSASAAQFTEGKQYVSLPKPVAGEPQVMEFFSFFCPHCYQFERIYH
VNDAVKKNLPADTKLVKYHVDFLGGDLGPVVTQAWAVAMALGVEDKVTVPIFDGIQKTQT
ITDPASLKETFVKAAGISAADYDAAWNSFAVKALVAQQQKAAADVDLRGVPAMFVNGKYM
VNNGGLDTSSMDNFVADYANVVKFLVSQK