Protein Info for IAI47_00380 in Pantoea sp. MT58

Annotation: multidrug transporter subunit MdtD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 50 to 69 (20 residues), see Phobius details amino acids 77 to 99 (23 residues), see Phobius details amino acids 105 to 123 (19 residues), see Phobius details amino acids 135 to 157 (23 residues), see Phobius details amino acids 163 to 182 (20 residues), see Phobius details amino acids 197 to 217 (21 residues), see Phobius details amino acids 223 to 243 (21 residues), see Phobius details amino acids 263 to 284 (22 residues), see Phobius details amino acids 290 to 313 (24 residues), see Phobius details amino acids 326 to 346 (21 residues), see Phobius details amino acids 352 to 373 (22 residues), see Phobius details amino acids 393 to 416 (24 residues), see Phobius details amino acids 428 to 448 (21 residues), see Phobius details PF07690: MFS_1" amino acids 16 to 405 (390 residues), 150.8 bits, see alignment E=4.8e-48 TIGR00711: drug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) family" amino acids 17 to 429 (413 residues), 252.8 bits, see alignment E=3.2e-79

Best Hits

Swiss-Prot: 78% identical to HSRA_ECOLI: Probable transport protein HsrA (hsrA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 97% identity to pva:Pvag_3238)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (466 amino acids)

>IAI47_00380 multidrug transporter subunit MdtD (Pantoea sp. MT58)
MIKSARSMAGLPWIAAMAFFMQSLDATILNTALPAIATSLDRSPLAMQSAVISYTLTVAM
LIPVSGWLADRFGTRKVFIVAVSLFTLGSLACALSPTLSVLVMSRIVQGVGGAMMMPVAR
LALLRAYPRSELLPVLNFVTMPGLVGPILGPMLGGVLVTYATWHWIFLINIPIGILGIIY
ARKYMPDFTTPKRRFDFFGFILFGAGLVMISIGIELFGERIVSAWLAGGILLSGIVLLLL
YIVHARNHPSPLINLPMFKTRTFSVGIVGNIASRLGTGCVPFLMPLMLQVGFGFSAIIAG
CMMAPTALGSILAKSTVTQLLRWLGYRRLLVGITAIIGILIASFSLQSPAESIFVLLLPL
FILGMAMSTQFTAMNTITLADLNDDNASGGNSVLAVTQQLAISFGVAVSAAVLRFYQEFE
TSTISQFHATFLTMGIVTVLSALTFMLLKNGDGRNLISNRDKKKKR