Protein Info for IAI47_00365 in Pantoea sp. MT58

Annotation: ribose ABC transporter substrate-binding protein RbsB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF00532: Peripla_BP_1" amino acids 23 to 274 (252 residues), 93.5 bits, see alignment E=3.4e-30 PF13407: Peripla_BP_4" amino acids 25 to 277 (253 residues), 205.4 bits, see alignment E=2.4e-64 PF13458: Peripla_BP_6" amino acids 55 to 250 (196 residues), 42 bits, see alignment E=2e-14 PF13377: Peripla_BP_3" amino acids 154 to 281 (128 residues), 46.1 bits, see alignment E=1.2e-15

Best Hits

Swiss-Prot: 83% identical to RBSB_SALTY: Ribose import binding protein RbsB (rbsB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K10439, ribose transport system substrate-binding protein (inferred from 99% identity to pva:Pvag_3241)

MetaCyc: 83% identical to ribose ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-28-RXN

Predicted SEED Role

"Ribose ABC transport system, periplasmic ribose-binding protein RbsB (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (291 amino acids)

>IAI47_00365 ribose ABC transporter substrate-binding protein RbsB (Pantoea sp. MT58)
MKKLTALAMILGATLSTSAMAKDTIALVVSTLNNPFFVSLKEGAQKEADKLGYNLVVLDS
QNNPAKELANVQDLTVRGTKLLLINPTDSDAVGNAVKMANQAKIPVITLDRVAAQGTVVS
HVASDNRFGGKMAGDFIAKKVGENAKIIELQGIAGTSAARERGEGFKQAADAHKFQILAS
QPADFDRTKGLNVMQNLLQAHPDVQAVFAQNDEMALGALRALQTAGKTGVIVVGFDGTAD
GVKAVEAGKLSATVAQMPEKIGMIGVDTADKVLKGEKVQAVNPVDLKLVTQ