Protein Info for IAI47_00360 in Pantoea sp. MT58

Annotation: ribose ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 transmembrane" amino acids 24 to 48 (25 residues), see Phobius details amino acids 58 to 85 (28 residues), see Phobius details amino acids 98 to 120 (23 residues), see Phobius details amino acids 127 to 146 (20 residues), see Phobius details amino acids 171 to 191 (21 residues), see Phobius details amino acids 222 to 241 (20 residues), see Phobius details amino acids 253 to 269 (17 residues), see Phobius details amino acids 276 to 294 (19 residues), see Phobius details amino acids 300 to 317 (18 residues), see Phobius details PF02653: BPD_transp_2" amino acids 46 to 315 (270 residues), 159.4 bits, see alignment E=5.1e-51

Best Hits

Swiss-Prot: 86% identical to RBSC_ECOL6: Ribose import permease protein RbsC (rbsC) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 100% identity to pva:Pvag_3242)

MetaCyc: 86% identical to ribose ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-28-RXN

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (323 amino acids)

>IAI47_00360 ribose ABC transporter permease (Pantoea sp. MT58)
MTTQTLPASRRWFSKSWLLEQKSLIALMVLIAVVASQSPNFFTVANLFNILQQTSVNAIM
AVGMTLVILTSGIDLSVGSLLALTGAVGASLVGMEVNALVAVAASLALGAAIGGLTGTIV
ARGKVQAFIATLVMMLLLRGVTMVYTDGSPINTGFSANADLLGWFGIGRPLGIPAPVWLM
ALVFIAAWYMLQHTRLGRYIYALGGNEAATRLSGINVNRVKIIVYSLSGMLAALAGTIEV
ARLSSAQPTAGTGYELDAIAAVVLGGTSLAGGKGRIFGTLIGALILGFLNNGLNLMGVSS
YYQMIVKAVVILLAVLVDNKSSK