Protein Info for IAI47_00350 in Pantoea sp. MT58

Annotation: D-ribose pyranase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 139 PF05025: RbsD_FucU" amino acids 1 to 138 (138 residues), 156.3 bits, see alignment E=3.2e-50

Best Hits

Swiss-Prot: 71% identical to RBSD_KLEP3: D-ribose pyranase (rbsD) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K06726, D-ribose pyranase [EC: 5.-.-.-] (inferred from 98% identity to pva:Pvag_3244)

MetaCyc: 70% identical to D-ribose pyranase (Escherichia coli K-12 substr. MG1655)
RXN0-5304 [EC: 5.4.99.62]

Predicted SEED Role

"Ribose ABC transport system, high affinity permease RbsD (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.-.-.-

Use Curated BLAST to search for 5.-.-.- or 5.4.99.62

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (139 amino acids)

>IAI47_00350 D-ribose pyranase (Pantoea sp. MT58)
MKKGRLLNAELSHVIARLGHTDTLTIADAGLPIPAGPQRIDLALTPGTPDFMQVVNAVAL
EMQVESALIAEEIKQHNPQLHSALVAVLEALQQHQGNIITISYTSHEQFKQQTQRSQAVI
RSGECSPFANVILSAGVTF