Protein Info for IAI47_00320 in Pantoea sp. MT58

Annotation: ATPase RavA stimulator ViaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 486 PF05762: VWA_CoxE" amino acids 314 to 443 (130 residues), 32.5 bits, see alignment E=6.1e-12 PF13519: VWA_2" amino acids 326 to 425 (100 residues), 29.6 bits, see alignment E=9.3e-11

Best Hits

Swiss-Prot: 69% identical to VIAA_ERWT9: Protein ViaA (viaA) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: None (inferred from 97% identity to pva:Pvag_3250)

Predicted SEED Role

"FIG00637882: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (486 amino acids)

>IAI47_00320 ATPase RavA stimulator ViaA (Pantoea sp. MT58)
MISVETLSTLLSVGETELIEELIIALLASPQLALFFEKFPGLKKALLRDIPRWRAEITAD
LKATPVPATLAEEFQLFQRVQLLSDRDFSHQLNATLQALESLPSPFLDEANRLLQHTDIA
HLSSAQHQLFLQRWRLSLTLQTLTLNQQLLEQQRERLLAELQQRMALSGQLAPILGDDDE
AAAGRLWDMSKASLQPGDYQLMLQYGDFLAQQPELLKLAQQLGRSREAKSVPSQDAPMEA
FHHLVQEPASVPEEVSGIHQSDDVLRLLPPELAALSISELELEFYRRLVEKRLLTYKLQG
DAWHEKVTMRPASHQQHEEQPRGPFIVCVDTSGSMGGFNERCAKAFCLALLKVALADRRR
CYIMLFAHEVIGYELTGDDGLEQAIRFLSQRFRGGTDLAACLSSVVTRMEGALWQEADAV
IVSDFIAQRLPEEVIGAIKKRQRHNQQRFHAVAMSAHGKPGILRIFDHIWRFDTGMKSRL
LRHWRR