Protein Info for IAI47_00210 in Pantoea sp. MT58

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 transmembrane" amino acids 25 to 47 (23 residues), see Phobius details amino acids 54 to 74 (21 residues), see Phobius details amino acids 83 to 104 (22 residues), see Phobius details amino acids 110 to 130 (21 residues), see Phobius details amino acids 141 to 160 (20 residues), see Phobius details amino acids 166 to 186 (21 residues), see Phobius details amino acids 223 to 243 (21 residues), see Phobius details amino acids 262 to 282 (21 residues), see Phobius details amino acids 291 to 309 (19 residues), see Phobius details amino acids 315 to 336 (22 residues), see Phobius details amino acids 352 to 372 (21 residues), see Phobius details amino acids 378 to 399 (22 residues), see Phobius details PF00083: Sugar_tr" amino acids 17 to 187 (171 residues), 64.4 bits, see alignment E=9.4e-22 amino acids 211 to 398 (188 residues), 23.5 bits, see alignment E=2.4e-09 PF07690: MFS_1" amino acids 23 to 307 (285 residues), 139.5 bits, see alignment E=1.4e-44 amino acids 249 to 405 (157 residues), 58.7 bits, see alignment E=4.9e-20

Best Hits

KEGG orthology group: None (inferred from 99% identity to pva:Pvag_3272)

Predicted SEED Role

"Major facilitator superfamily (MFS) transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (413 amino acids)

>IAI47_00210 MFS transporter (Pantoea sp. MT58)
MMSPSPQSKPGVTPGKAMLAAVSGYAMDGFDLLILGFMLPAISVSLALNPSQAGSLVTWT
LIGAVIGGIVFGHLSDRYGRIRMLTVTILVFSIFTGLCAVAQGYWDLLAWRTLAGVGLGG
EFGIGMALIAEAWPAEKRNRASAWVGIGWQLGVLMAAFITPPLLNIIGWRGMFLVGLLPA
LVSFAIRRGMGEPEAYQRQVKHVPSLSFPARLKLLVRDRATAKASLGIFILCSVQNFGYY
GLMIWMPSYLSSSFGFSLTKSGLWTAVTVVGMTFGIWLFGVLADRFARWKIFLLYQFGAV
VMVVVYAQLRDPNIMLFTGAIMGMFVNGMIGGYGALISDTFPPQVRATAQNVLFNLGRGV
GGFGPVVIGLLASQFSFTAAITLLALIYLLDIVATLFLLPKKQSQEDTLGAIG