Protein Info for IAI47_00180 in Pantoea sp. MT58

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 transmembrane" amino acids 27 to 46 (20 residues), see Phobius details amino acids 61 to 82 (22 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details amino acids 112 to 132 (21 residues), see Phobius details amino acids 139 to 157 (19 residues), see Phobius details amino acids 177 to 197 (21 residues), see Phobius details amino acids 218 to 236 (19 residues), see Phobius details amino acids 242 to 261 (20 residues), see Phobius details amino acids 291 to 310 (20 residues), see Phobius details amino acids 327 to 358 (32 residues), see Phobius details amino acids 370 to 386 (17 residues), see Phobius details PF02653: BPD_transp_2" amino acids 58 to 384 (327 residues), 139.6 bits, see alignment E=5.4e-45

Best Hits

Swiss-Prot: 86% identical to XYLH_SHIFL: Xylose transport system permease protein XylH (xylH) from Shigella flexneri

KEGG orthology group: K10544, D-xylose transport system permease protein (inferred from 99% identity to pva:Pvag_3277)

MetaCyc: 86% identical to xylose ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-33-RXN [EC: 7.5.2.10, 7.5.2.13]

Predicted SEED Role

"Xylose ABC transporter, permease protein XylH" in subsystem Xylose utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.10 or 7.5.2.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (394 amino acids)

>IAI47_00180 sugar ABC transporter permease (Pantoea sp. MT58)
MLKSESTQSRLSGTPGKPSPGRFTLPNLQVLVMLGAIVLIALFFTWTTDGSWLSARNVSN
LLRQTAITGILAVGMVFVIISAEIDLSVGSMMGLLGGAAAIFDVWLGWPLPLTIVVTLVM
GLLLGTWNGWWVAYRKVPSFIVTLAGMLAFRGILVGITDGTTVAPITPGMSQIGQSYLPG
GVGFGFGVAGLALFTLWQWRLRLRRQQLGLPQGAASGTVGRQAITAILVLGAIWLLNDYR
GVPTPVLLLAVLLLAGMFMATRTAFGRRIYAIGGNIDAARLSGINVARTKLAVFAINGVM
VAIAGLILSSRLGAGSPSAGNIAELDAIAACVIGGTSLAGGVGSVAGAVMGAFIMASLDN
GMSMMDVPTFWQYIVKGAILLLAVWMDTATRRRV