Protein Info for IAI47_00175 in Pantoea sp. MT58

Annotation: XylR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 PF13407: Peripla_BP_4" amino acids 89 to 257 (169 residues), 47 bits, see alignment E=5.3e-16 PF13377: Peripla_BP_3" amino acids 113 to 277 (165 residues), 126.7 bits, see alignment E=2.1e-40 PF12833: HTH_18" amino acids 309 to 385 (77 residues), 71 bits, see alignment E=1.7e-23 PF00165: HTH_AraC" amino acids 347 to 385 (39 residues), 44.6 bits, see alignment 2.3e-15

Best Hits

Swiss-Prot: 83% identical to XYLR_ECOLI: Xylose operon regulatory protein (xylR) from Escherichia coli (strain K12)

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 99% identity to pva:Pvag_3278)

Predicted SEED Role

"Xylose activator XylR (AraC family)" in subsystem Xylose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (392 amino acids)

>IAI47_00175 XylR family transcriptional regulator (Pantoea sp. MT58)
MHDKRYRITLLFNANKVYDRQVVEGVGEYLQASQTDWDIFIEEDFRCRIDNIREWLGDGV
IADYDDRSIEALLSNVSVPIVGVGGSYHRQEDYPPVHYIATDNAALVEKAFLHLKEKGIN
RFAFYGLPASSGKRWAQEREQAFRQLVGRERYQGVVYQGMETAPENWQHAQNRLADWLQT
LPPQTGIIAVTDSRARHLLQACEHLKIPVPEKLTVIGIDNEELTRYLSRVALSSVAQGSR
QMGYQAAKLLHRLLDNQPLPLQRILVPPVKVIARRSTDFRSLRDPAVIQAMHYIRFNACK
GIKVEQVLDAVGLSRSNLEKRFRDETGDTIHAMIHREKLEKARELLASSSLNINEISQMC
GYPSLQYFYSVFRKSYDTTPKEYRQHFGENVL