Protein Info for IAI47_00145 in Pantoea sp. MT58

Annotation: DNA-3-methyladenine glycosylase I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00624: DNA-3-methyladenine glycosylase I
  • amino acids 2 to 181 (180 residues), 258.2 bits, E=1.7e-81
• PF03352: Adenine_glyco
  • amino acids 6 to 182 (177 residues), 260.3 bits, E=4.6e-82

Best Hits

Swiss-Prot: 64% identical to 3MG1_ECOLI: DNA-3-methyladenine glycosylase 1 (tag) from Escherichia coli (strain K12)

KEGG orthology group: K01246, DNA-3-methyladenine glycosylase I [EC: 3.2.2.20] (inferred from 92% identity to pva:Pvag_3285)

MetaCyc: 64% identical to 3-methyl-adenine DNA glycosylase I, constitutive (Escherichia coli K-12 substr. MG1655)
DNA-3-methyladenine glycosylase I. [EC: 3.2.2.20]

Predicted SEED Role

"DNA-3-methyladenine glycosylase (EC 3.2.2.20)" in subsystem DNA Repair Base Excision (EC 3.2.2.20)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.2.20

Protein Sequence (188 amino acids)

>IAI47_00145 DNA-3-methyladenine glycosylase I (Pantoea sp. MT58)
MQRCGWVTQDPLYLAYHDREWGVVQRDKRALFEMLCLEGQQAGLSWITVLKKRENYRAAF
HQFDPQAIALMDSTDIDALMLNSGIIRHAGKIAAIIANARAYLEMETKGEDFSHFVWQFV
DNVQIVHDYPDYSQAPTTSEHAIALSKALKQRGFKFIGPTICYSFMQACGLINDHQSNCF
CHPDNQKT