Protein Info for IAI47_00115 in Pantoea sp. MT58

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 51 to 72 (22 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 106 to 128 (23 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 169 to 189 (21 residues), see Phobius details amino acids 233 to 254 (22 residues), see Phobius details amino acids 270 to 290 (21 residues), see Phobius details amino acids 299 to 318 (20 residues), see Phobius details amino acids 324 to 348 (25 residues), see Phobius details amino acids 359 to 379 (21 residues), see Phobius details amino acids 391 to 410 (20 residues), see Phobius details PF07690: MFS_1" amino acids 18 to 375 (358 residues), 193 bits, see alignment E=1.1e-60 amino acids 266 to 419 (154 residues), 56.6 bits, see alignment E=3.3e-19 PF00083: Sugar_tr" amino acids 49 to 410 (362 residues), 37.2 bits, see alignment E=2.6e-13 PF11700: ATG22" amino acids 165 to 411 (247 residues), 26.1 bits, see alignment E=5.5e-10

Best Hits

KEGG orthology group: None (inferred from 99% identity to pva:Pvag_3291)

Predicted SEED Role

"2-ketogluconate transporter" in subsystem 2-Ketogluconate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (426 amino acids)

>IAI47_00115 MFS transporter (Pantoea sp. MT58)
MKKQTIAPKRWWFIMPIVFITYSLAYLDRANFSFASAAGINDDLGITKGMSSLLGALFFL
GYFFFQIPGAIYAERRSVKKLIFVCLILWGGCASLTGVVSNIPMLAAIRFVLGVVEAAVM
PAMLIYISNWFTKSERSRANTFLILGNPVTVLWMSVVSGYLIESFGWREMFIIEGIPAVI
WAIAWWFLVQDKPAQARWMSDAEKAALQAELQKEQENIKAVRNYGEAFRNRNVIILCLQY
FAWSIGVYGFVLWLPSILRNGTQMGMVEAGWLSAVPYLAATIAMVIVSWASDKTQNRKLF
VWPLLLIGALAFLGSYLVGSNHFWMSYTLLVIAGAAMYAPYGPFFAIIPEMLPRNVAGGA
MALINSMGALGSFIGSWIVGYLNGATGSPSASYIFMGSALLVSVWLTLIVKPAQNKAPPL
QGAKPA