Protein Info for IAI47_00070 in Pantoea sp. MT58

Annotation: O-acetylserine/cysteine exporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 33 to 51 (19 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 86 to 109 (24 residues), see Phobius details amino acids 116 to 135 (20 residues), see Phobius details amino acids 141 to 161 (21 residues), see Phobius details amino acids 176 to 198 (23 residues), see Phobius details amino acids 211 to 234 (24 residues), see Phobius details amino acids 246 to 265 (20 residues), see Phobius details amino acids 275 to 294 (20 residues), see Phobius details PF00892: EamA" amino acids 6 to 131 (126 residues), 58.5 bits, see alignment E=8.4e-20 amino acids 148 to 288 (141 residues), 54.3 bits, see alignment E=1.7e-18

Best Hits

Swiss-Prot: 62% identical to EAMA_ECOLI: Probable amino-acid metabolite efflux pump (eamA) from Escherichia coli (strain K12)

KEGG orthology group: K03298, drug/metabolite transporter, DME family (inferred from 98% identity to pva:Pvag_3300)

MetaCyc: 62% identical to cysteine/O-acetylserine exporter EamA (Escherichia coli K-12 substr. MG1655)
RXN0-1923; RXN0-1924

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (303 amino acids)

>IAI47_00070 O-acetylserine/cysteine exporter (Pantoea sp. MT58)
MSVKDMLLALCVVVAWGVNFVVIKLGLQGMPPFLLAGLRFSLVAFPAIFFVRRPPIPLRW
LVVYGMTISFGQFAFLFLAIKLGMPAGLASLVLQAQAFFTLLLGALLLAEKLRWNHIVGI
IIATLGMFMLATAGMEGQTSAGITLTTMMLTLSAALSWGLGNITNKIIMRNRSVPIMSLV
VWSALVPVIPFFACSLLFDGEAAIVNSLLHIGLQTVLALFYLAFVATIVGYAIWGNLLSR
YETWRVAPLSLLVPVVGIVTAALVLDEHLSGQQMLGAAVIILGLLVNVFGGVLGQRLAMR
TQP