Protein Info for HSERO_RS23970 in Herbaspirillum seropedicae SmR1

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 transmembrane" amino acids 7 to 32 (26 residues), see Phobius details amino acids 72 to 92 (21 residues), see Phobius details amino acids 99 to 116 (18 residues), see Phobius details amino acids 136 to 165 (30 residues), see Phobius details amino acids 176 to 196 (21 residues), see Phobius details amino acids 202 to 222 (21 residues), see Phobius details amino acids 230 to 248 (19 residues), see Phobius details PF01925: TauE" amino acids 8 to 245 (238 residues), 158.9 bits, see alignment E=8.8e-51

Best Hits

KEGG orthology group: None (inferred from 100% identity to rcu:RCOM_1861740)

Predicted SEED Role

"FIG011065: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IZ48 at UniProt or InterPro

Protein Sequence (253 amino acids)

>HSERO_RS23970 membrane protein (Herbaspirillum seropedicae SmR1)
VLDYLILCGAAFVAGLIDAVVGGGGLVLVPTLFSVFPTTTPATLLGTNKVTGVMGTSAAA
INFARKVAVRWSTVTPAAMAAFAFSFFGAYVVTHIPTDLIRKALPFVLIAVALYTLKKKD
FGTTHAPTLSGSREIFYAALIGGAVGFYDGVFGPGTGSFLVFLFVRVFSYDFLSASAAAK
FVNVATNLAALCWFGYSGHVIWQLGLLMAVFNVAGSLVGTKLAMKHGSVFVRKLFLVVVG
VLILKSGYDAFLR