Protein Info for HSERO_RS23605 in Herbaspirillum seropedicae SmR1
Annotation: urease accessory protein UreD
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 69% identical to URED_JANMA: Urease accessory protein UreD (ureD) from Janthinobacterium sp. (strain Marseille)
KEGG orthology group: K03190, urease accessory protein (inferred from 100% identity to hse:Hsero_4718)Predicted SEED Role
"Urease accessory protein UreD" in subsystem Urea decomposition
MetaCyc Pathways
- urea degradation II (1/1 steps found)
- superpathway of allantoin degradation in plants (2/8 steps found)
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See D8IY62 at UniProt or InterPro
Protein Sequence (287 amino acids)
>HSERO_RS23605 urease accessory protein UreD (Herbaspirillum seropedicae SmR1) MPAPATPGAPLRHAPDQARLALGFADDKGTTRLMRRQHFGPLRVQKPLYPEDPSICHAII VHPPGGIVGGDQLSITAEAGERAHALLTTPGAGKWYRANGQSSRQAVRLDAAAGATLEWL PQETIFFDGAEVRMEHEVTLAANAAYLGAEILCFGRTASGETFNTGAISQRTSIRRGGKL VWFEQGRLQAEAGAMQGPLALDGQTICGTLIAVGDGMDAALLGHLRETIGALQLEGRSGA TLMKQVLIARYMGQSSLVARQWLHAAWHVLRPAVTGKEAAIPRIWNT