Protein Info for HSERO_RS23570 in Herbaspirillum seropedicae SmR1

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 573 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 306 to 325 (20 residues), see Phobius details PF00672: HAMP" amino acids 323 to 375 (53 residues), 51.5 bits, see alignment 1e-17 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 398 to 565 (168 residues), 180.1 bits, see alignment E=1.5e-57 PF00990: GGDEF" amino acids 403 to 562 (160 residues), 170.9 bits, see alignment E=1.9e-54

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_4711)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IY55 at UniProt or InterPro

Protein Sequence (573 amino acids)

>HSERO_RS23570 diguanylate cyclase (Herbaspirillum seropedicae SmR1)
MRKRLDFLSRHFLRRIAIGYRLISAFILVSLLPLLISGLLAYGETSRATQDKVRAYSVQV
VQQISQNLLLRMEKIEDTSEALALSEKMQRLLADYYSGDADASAAARNSAARVLLDTYGA
LTYVNQKYLLDRDRQVIDPQIFAPLASSIGRVAEEAPELTGRGWWTLYHAGHGQKSLAML
REVRFTANNRPAGVLFVGVHPSYFFDIFRGADLGYGASISIVDASDGAVVVQSRESSASQ
ADPALLGGITESLAQGRDSDFIAYVGADKTPYYAAIARLPHTSWWVASITPSDRLNADTR
SVRDKIIAIGLVCFAVSLLLSALISRSISVPLQRLVAAMKEAGSGDTTVRVEQHGNDEIA
VLSRKFNEMAGKLQQNREVLEEQVRLRTRELERANRKLEALSATDGLTGVANRRRFDEAL
ANEMRRAVRSGQSLALLMLDVDYFKKYNDRYGHLAGDECLRIVARVLQKSSRRATDLVAR
YGGEEFSVIIAECDTTQALQQAENICQAIFELKLPHADSPFGYISASIGVAVLLPDEHTA
PEQMVRIADQALYHAKYQGRNRVVLGSDATQGL