Protein Info for HSERO_RS23555 in Herbaspirillum seropedicae SmR1

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 34 to 50 (17 residues), see Phobius details amino acids 63 to 83 (21 residues), see Phobius details amino acids 95 to 112 (18 residues), see Phobius details amino acids 119 to 136 (18 residues), see Phobius details amino acids 142 to 158 (17 residues), see Phobius details amino acids 170 to 187 (18 residues), see Phobius details amino acids 202 to 222 (21 residues), see Phobius details amino acids 233 to 253 (21 residues), see Phobius details amino acids 259 to 279 (21 residues), see Phobius details PF00892: EamA" amino acids 2 to 135 (134 residues), 55.1 bits, see alignment E=4.7e-19 TIGR00688: protein RarD" amino acids 2 to 251 (250 residues), 220.1 bits, see alignment E=1.7e-69

Best Hits

Swiss-Prot: 41% identical to RARD_STREX: Protein RarD (rarD) from Streptomyces exfoliatus

KEGG orthology group: K05786, chloramphenicol-sensitive protein RarD (inferred from 100% identity to hse:Hsero_4708)

Predicted SEED Role

"Protein rarD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IY52 at UniProt or InterPro

Protein Sequence (298 amino acids)

>HSERO_RS23555 membrane protein (Herbaspirillum seropedicae SmR1)
MLYAVAASILWGLFPLYFKLLKEIPSFDIVVHRLFWSCVFLVAVLTWRRQWRWVGEVVKR
PMVVGGFLLSALLLTGNWTLYVWAVNAGRIVDTSLGYFMSPLMSVFMGYLILKERMRPLQ
WLAVFLALGAVIWLTIANGSLPWVSLLIALSFAFYGLLRKTAHLGALEGLSLETLLMLPL
VLLVLGVDTLRDSNAFTHASTSARILLALSGPITAVPLLLFAHGARRIPLSMLGLMQYIS
PTIQLLGGVLIYGEAFTGARAIGFCVIWAALAVYSAEGLWRYLRTRAQSSAEPSAGGA